PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43434.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 238aa    MW: 26734.8 Da    PI: 7.1629
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43434.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.92.7e-09542148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l ++++ +G g          ++Rt+k+c++rw++yl
       KHN43434.1  5 KGPWTEEEDSVLFNYITVHGEG----------LKRTGKSCRLRWLNYL 42
                     79******************99..........68************97 PP

2Myb_DNA-binding52.21.4e-164891146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
       KHN43434.1 48 RGNITLEEQLLILDLHSRWGNR-WSKIAEHLP-GRTDNEIKNYWRT 91
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.63142IPR017930Myb domain
SuperFamilySSF466892.92E-25289IPR009057Homeodomain-like
SMARTSM007174.3E-5444IPR001005SANT/Myb domain
PfamPF002499.6E-7542IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-13649IPR009057Homeodomain-like
PROSITE profilePS5129423.7084397IPR017930Myb domain
SMARTSM007172.8E-144795IPR001005SANT/Myb domain
PfamPF002495.7E-154891IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-225095IPR009057Homeodomain-like
CDDcd001671.11E-115291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSITKGPWTE EEDSVLFNYI TVHGEGLKRT GKSCRLRWLN YLRPNVRRGN ITLEEQLLIL  60
DLHSRWGNRW SKIAEHLPGR TDNEIKNYWR TRVVKQAKQL KCEVNSKQFR DTLRFVWMPR  120
MLERIQAQAS SSSSSSSGQA HQTTLISNAQ AHSDPCGVMT TNPSLLSEVS SSALDAHAPS  180
LYDSSASYNL MGGGSSSSYS AEYCYYSDIA GNGFGGSDLW TDENICFLQQ LLADHDLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2128924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF5104670.0JF510467.1 Glycine max MYB transcription factor MYB12B2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241924.11e-158uncharacterized LOC100819467
SwissprotQ9LDE17e-63MY108_ARATH; Transcription factor MYB108
TrEMBLC5NU131e-179C5NU13_SOYBN; MYB12 transcription factor b
STRINGGLYMA19G40650.11e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.16e-70myb domain protein 2